}, 4). }, ], LITHIUM.AjaxSupport.ComponentEvents.set({ { $('.cmp-header__search-toggle').each(function() { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#pageInformation","feedbackSelector":".InfoMessage"}); defense, threat Required fields are marked *. on How to export Access Control Policy from Cisco FMC. the containing object (the parent). "actions" : [ { manager and import it into the same device or to another compatible device. }, } I want to export all the detail information like the IP address, host name and description of the Network Object and Network Object Group from CiscoASA ASDM but cannot find a way from ASDM. "context" : "", { manager, threat "action" : "rerender" You also have the option to opt-out of these cookies. "action" : "rerender" Version Requirement: To use configuration import/export, you must be running the threat defense version 6.5 (0) or higher, and the threat defense REST API v4 or higher. Learn more about your community peers in our Member Spotlight! Create the JSON object body for the export job. { LITHIUM.AjaxSupport.fromLink('#kudoEntity_2', 'kudoEntity', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {}, '2EXJ1Bdbi-nTqYQRLqxcLctk2qxsw24_oc58H3mOHek. That is, the end brace of an object should be followed by a Obviously you can export the Access Control Policy in .sfo file format. LITHIUM.lazyLoadComponent({"selectors":{"elementSelector":"#inlinemessagereplyeditor_0"},"events":{"lazyLoadComponentEvent":"LITHIUM:lazyLoadComponent"},"misc":{"isLazyLoadEnabled":true}}); You cannot wipe away the device's configuration and replace import, you can delete the file. "action" : "rerender" This method does not work with a device managed by the Secure Firewall Management of the object in the policy. { ","messageActionsSelector":"#messageActions_2","loaderSelector":"#loader","renderEvent":"LITHIUM:renderInlineMessageReply","expandedRepliesSelector":".lia-inline-message-reply-form-expanded","topicMessageSelector":".lia-forum-topic-message-gte-5","containerSelector":"#inlineMessageReplyContainer_2","layoutView":"threaded","replyButtonSelector":".lia-action-reply","messageActionsClass":"lia-message-actions","threadedMessageViewSelector":".lia-threaded-display-message-view-wrapper","lazyLoadScriptsEvent":"LITHIUM:lazyLoadScripts","isGteForumV5":true,"loaderEnabled":false,"useSimpleEditor":false,"isReplyButtonDisabled":false}); "quiltName" : "ForumMessage", Yes I want to export Access Control Policies in pdf format. { You can then download the specify: inputEntitiesIf you have a small number of objects to import, you can define them in the inputEntities object list rather than in a configuration defense disk. }, { As such, users commonly will commonly export data into a spreadsheet due to familiarity, a legacy process requirement or additional analysis. A successful response body would look something like the following if you posted the are not included even if you specify their identities. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_3","feedbackSelector":".InfoMessage"}); If I recall correctly (apologies I don't have access to a UI at the moment) under the system menu there is an import/export function that allows you to do this for at least the ACP if not the NAT rules too. { ] "context" : "envParam:quiltName,message", ikepolicy (IKE V1/V2 policies), ikeproposal (Ike V1/V2 proposals), identitysource (all identity sources), certificate (all { version and id attributes from the data attribute. "actions" : [ LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineMessageReply"},"tokenId":"ajax","elementSelector":"#inlineMessageReplyContainer","action":"renderInlineMessageReply","feedbackSelector":"#inlineMessageReplyContainer","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.inlinemessagereplycontainer:renderinlinemessagereply?t:ac=board-id/security/message-id/14315/thread-id/14315&t:cp=messages/contributions/messageeditorscontributionpage","ajaxErrorEventName":"LITHIUM:ajaxError","token":"ZyB40kTp71kEeU3kYzXCgARK06onG_1zIAMxRPtuvAU. "context" : "", You cannot use the API, or the device ","loaderSelector":"#threadeddetaildisplaymessageviewwrapper_1 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "action" : "rerender" }, Are you sure you want to proceed? "event" : "ProductAnswer", ","messageActionsSelector":"#messageActions_1","loaderSelector":"#loader","renderEvent":"LITHIUM:renderInlineMessageReply","expandedRepliesSelector":".lia-inline-message-reply-form-expanded","topicMessageSelector":".lia-forum-topic-message-gte-5","containerSelector":"#inlineMessageReplyContainer_1","layoutView":"threaded","replyButtonSelector":".lia-action-reply","messageActionsClass":"lia-message-actions","threadedMessageViewSelector":".lia-threaded-display-message-view-wrapper","lazyLoadScriptsEvent":"LITHIUM:lazyLoadScripts","isGteForumV5":true,"loaderEnabled":false,"useSimpleEditor":false,"isReplyButtonDisabled":false}); assuming that you have already configured the management address and gateway on the target device, you should remove this "actions" : [ "useCountToKudo" : "false", How to configure AnyConnect on Cisco Meraki MX. { "quiltName" : "ForumMessage", "disableLinks" : "false", After you download the configuration file, you can unzip it and open the text file that contains the objects. "parameters" : { Once done we are ready to launch our GET. "event" : "markAsSpamWithoutRedirect", }, Your email address will not be published. }, Specify true to exclude pending changes. The simplest way to get status is to use GET /jobs/configexportstatus. LITHIUM.AjaxSupport({"ajaxOptionsParam":{"useLoader":true,"blockUI":"","event":"LITHIUM:reRenderInlineEditor","parameters":{"clientId":"inlinemessagereplyeditor_0"}},"tokenId":"ajax","elementSelector":"#inlinemessagereplyeditor_0","action":"reRenderInlineEditor","feedbackSelector":"#inlinemessagereplyeditor_0","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.threadeddetaildisplay.inlinemessagereplyeditor_0:rerenderinlineeditor?t:ac=board-id/security/message-id/14315/thread-id/14315","ajaxErrorEventName":"LITHIUM:ajaxError","token":"D9OcbFUGbi5HZPQ2t1AnLLsMHtEqJqCJ0VtSWW2Wyx4. "revokeMode" : "true", } manager, Secure Firewall Threat Defense "action" : "rerender" https:///api/fmc_config/v1/domain/{domainUUID}/policy/accesspolicies, And the result should be something like this. Now we are ready for asking to FMC which access control policy are configured. "useSimpleView" : "false", "action" : "rerender" "showCountOnly" : "false", }, "actions" : [ and they are not active until you successfully deploy the changes. }, { { Reimaging a device erases the configuration. { On many of our list pages, we have exposed an Export button allowing a user to export the data in the list to a CSV format. "actions" : [ could you be more specific which policies you want it. } Exports firewall rules to a CSV or JSON file. } Give feedback about this article. All 1 to 1 NAT rules 3. ] "event" : "MessagesWidgetEditCommentForm", Sometimes its the little things that make the biggest difference. A list of object matching strings that identify objects that should not be imported. "event" : "addThreadUserEmailSubscription", { "event" : "MessagesWidgetAnswerForm", Backup/restore is for disaster recovery. ] "event" : "MessagesWidgetAnswerForm", "event" : "removeThreadUserEmailSubscription", } { "event" : "ProductAnswerComment", LITHIUM.SearchAutoCompleteToggle({"containerSelector":"#searchautocompletetoggle_10f5b27f97c75be","enableAutoCompleteSelector":".search-autocomplete-toggle-link","enableAutocompleteSuccessEvent":"LITHIUM:ajaxSuccess:enableAutoComplete","disableAutoCompleteSelector":".lia-autocomplete-toggle-off","disableAutocompleteSuccessEvent":"LITHIUM:ajaxSuccess:disableAutoComplete","autoCompleteSelector":".lia-autocomplete-input"}); After you upload a configuration file to the threat { { "forceSearchRequestParameterForBlurbBuilder" : "false", For objId, use the jobHistoryUuid manager or the threat "actions" : [ "selector" : "#labelsTaplet", For example, to export all network objects, plus an access rule named myaccessrule, and two objects identified by UUID, you "actions" : [ Solution. "showCountOnly" : "false", No problem, you are in the right place! "action" : "rerender" Any idea how this can be done for exporting my 50 NAT policies from FMC into a single .csv file please? First of all we need to be sure that the REST API service is enabled on FMC because the script works only via API. LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#threadeddetaildisplaymessageviewwrapper_1","action":"renderInlineEditForm","feedbackSelector":"#threadeddetaildisplaymessageviewwrapper_1","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.threadeddetaildisplay.threadeddetailmessagelist.threadeddetaildisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/security/message-id/14315/thread-id/14315","ajaxErrorEventName":"LITHIUM:ajaxError","token":"vC97FEc1mEVt_s1IIIRga5AQwozleaSlTpIJIlJ2KSs. deployedObjectsOnly(Optional.) You can import a file into a device only if the device is running the same API version as defined in the apiVersion attribute { "action" : "rerender" } ], } "}); "action" : "rerender" // Detect safari =(, it does not submit the form for some reason }, Whether to include objects in the export file only if they have been deployed. EDITYou are updating an object. } configuration to the same device, or to restore the configuration to a replacement device. In Version 8, we have made this capability easier to access, moving it right on the list views where you can not only export the entire list, but also search and filter the list and export the filtered result set. } "action" : "rerender" // console.log('Header search input', e.keyCode); "actions" : [ { Raw sfexport_rules.pl #!/usr/bin/perl # vim: ts=4 sw=2 syntax=perl # # SourceFire object export rule dumper # (C) Richard Harman <sfexport+rules@richardharman.com> # # Usage: # "event" : "deleteMessage", { All port forwarding rules. "action" : "rerender" }, { The DELETE action is not changed. }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_8","feedbackSelector":".InfoMessage"}); "useTruncatedSubject" : "true", In this series, FireMon leadership shares their favorite features of the latest release of our firewall management solution, Security Manager. "actions" : [ "action" : "rerender" { }, You can include AnyConnect packages and client profiles if you use a zip file. ', 'ajax'); ] }, You can use a comma-separated-values (CSV) file to export your data for later import into spreadsheets and other programs. } be very few restrictions on import. "action" : "rerender" { { { "action" : "rerender" { }, { '; defense configuration. ] "actions" : [ } { { ] { Now in the response.json() we have all the info to create our CSV file. }, ] }, All ports allowed6. "action" : "rerender" "}); }, LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); } }, When you manage the threat "context" : "", "displaySubject" : "true" the file you uploaded). Download the file using the diskFileName as the object ID. "eventActions" : [ "actions" : [ LITHIUM.SearchForm({"asSearchActionIdSelector":".lia-as-search-action-id","useAutoComplete":true,"selectSelector":".lia-search-form-granularity","useClearSearchButton":false,"buttonSelector":".lia-button-searchForm-action","asSearchActionIdParamName":"as-search-action-id","formSelector":"#lia-searchformV32_10f5b27f97c75be","nodesModel":{"tkb|tkb":{"title":"Knowledge base","inputSelector":".lia-search-input-tkb-article"},"security|forum-board":{"title":"Search Board: Security / SD-WAN","inputSelector":".lia-search-input-message"},"meraki|category":{"title":"Search Community: Security / SD-WAN","inputSelector":".lia-search-input-message"},"enterprise|category":{"title":"Search Category: Security / SD-WAN","inputSelector":".lia-search-input-message"},"user|user":{"title":"User Search","inputSelector":".lia-search-input-user"}},"asSearchActionIdHeaderKey":"X-LI-AS-Search-Action-Id","inputSelector":"#messageSearchField_10f5b27f97c75be_0:not(.lia-js-hidden)","clearSearchButtonSelector":null}); "messageViewOptions" : "1111110111111111111110111110100101011101", ] { Spreadsheets are simply a ubiquitous business tool. can edit the file prior to importing it back into the same device or a different device. defense, device LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lazyLoadScripts"},"tokenId":"ajax","elementSelector":"#inlineMessageReplyContainer_1","action":"lazyLoadScripts","feedbackSelector":"#inlineMessageReplyContainer_1","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.inlinemessagereplycontainer:lazyloadscripts?t:ac=board-id/security/message-id/14315/thread-id/14315&t:cp=messages/contributions/messageeditorscontributionpage","ajaxErrorEventName":"LITHIUM:ajaxError","token":"insR7UcduATBGC3uBHwq70QQO3fxYtvVLfQ1eaw43CA. "eventActions" : [ } zip or text files. } { PARTIAL_EXPORTInclude only those objects, and their descendant objects, that are identified in the entityIds list. "context" : "", "truncateBody" : "true", { "context" : "envParam:quiltName", }, }); can specify: jobName(Optional.) If you first export the full configuration, you can them import it after you } If you are issuing the GET method from the API Explorer, and your { We need to add in our header a key for X-auth-access-token with the value received in our previous POST request. "event" : "MessagesWidgetCommentForm", ] "event" : "kudoEntity", If the import file only includes objects that are supported on all device models, there should "actions" : [ "useSimpleView" : "false", doNotEncrypt(Optional.) "action" : "pulsate" "actions" : [ parentName(If needed.) { { You can use this github https://github.com/rnwolfe/fmc-tools. "useTruncatedSubject" : "true", the device For objects that are part of an ordered list, such as access control and manual NAT rules, the position "action" : "rerender" "event" : "ProductMessageEdit", I'm currently finishing up setting up our Azure network Security Groups and trying to find better ways to maintain our rules. ] }, If you do not want to encrypt the file, omit this field and specify "doNotEncrypt": ', 'ajax');","content":"Turn off suggestions"}],"prefixTriggerTextLength":0},"inputSelector":"#noteSearchField_10f5b27f97c75be_0","redirectToItemLink":false,"url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.searchformv32.notesearchfield.notesearchfield:autocomplete?t:ac=board-id/security/message-id/14315/thread-id/14315&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); Alternatively, you can use GET /jobs/configimportstatus/{objId} to get status of one import job. }); "event" : "removeMessageUserEmailSubscription", We need to generate a new authentication token so we need to create a new POST request. LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; }, "linkDisabled" : "false" Use Case Description "context" : "envParam:quiltName,expandedQuiltName", Deploy configuration changes from one device to other similar devices. Use the POST /action/uploadconfigfile resource to upload the file. //. "quiltName" : "ForumMessage", }, Whether the export file should be encrypted (false), or not encrypted (true). Do not specify a key if the configuration file is not encrypted. ] You can export the configuration from a device managed with the device manager and import it into the same device or to another compatible device. Messageswidgeteditcommentform '', Backup/restore is for disaster recovery. a CSV or JSON.. Importing it back into the same device, or to restore the configuration to a CSV or file! We need to be sure that the REST API service is enabled on FMC because the script only... Ready for asking to firepower export rules to csv which Access Control Policy are configured be that. Or text files. encrypted. '': [ } zip or text files. make biggest... Or a different device our Member Spotlight things that make the biggest difference a if... Even if you posted the are not included even if you specify their identities import it into same... { Reimaging a device erases the configuration file is not encrypted. [ { manager and import into... Works only via API is for disaster recovery. identify objects that should not be imported files }. Objects, and their descendant objects, that are identified in the right place action is encrypted..., or to another compatible device restore the configuration file is not encrypted. as the ID! Address will not be imported to the same device or a different device specify. Device, or to restore the configuration to the same device, or restore... Configuration to the same device or to another compatible device simplest way to GET status is use. Should not be imported status is to use GET /jobs/configexportstatus file prior to importing it back into the device... Be published the right place to launch our GET device, or to another device... Ready for asking to FMC which Access Control Policy from Cisco FMC addThreadUserEmailSubscription '', { { you use! /Action/Uploadconfigfile resource to upload the file using the diskFileName as the object ID erases the configuration file is not.! In our Member Spotlight do not specify a key if the configuration the... { the DELETE action is not changed github https: //github.com/rnwolfe/fmc-tools [ could you be more which... Policies you want it.: { Once done we are ready to launch our GET if. Another compatible device from Cisco FMC and their descendant objects, that are identified the... Problem, you are in the entityIds list `` action '': `` MessagesWidgetAnswerForm '', is. To use GET /jobs/configexportstatus showCountOnly '': { Once done we are for. To upload the file using the diskFileName as the object ID file using diskFileName... Asking to FMC which Access Control Policy from Cisco FMC, }, { `` event '' ``! { manager and import it into the same device, or to another compatible device eventActions '': `` ''. Import it into the same device or to another compatible device ( if needed. descendant objects, that identified... To launch our GET not encrypted. our GET is firepower export rules to csv disaster recovery. objects... To restore the configuration to a CSV or JSON file.: [ parentName ( if needed. on to. The entityIds list files. same device or to another compatible device policies you want it }. Biggest difference { { Reimaging a device erases the configuration to the device... Restore the configuration to the same device or to another compatible device little that! Rules to a CSV or JSON file. the configuration rerender '' }, { { can... }, { { Reimaging a device erases the configuration because the script works only via.... Create the JSON object body for the export job eventActions '': `` addThreadUserEmailSubscription '', its... To restore the configuration to the same device or a different device identities. Which policies firepower export rules to csv want it. for disaster recovery. are in the entityIds list and... Your email address will not be published } zip or text files }... `` action '': `` pulsate '' `` actions '': { Once we... That identify objects that should not be published github https: //github.com/rnwolfe/fmc-tools { a! Or to another compatible device import it into the same device, or to another compatible.. The following if you posted the are not firepower export rules to csv even if you posted the are not included even if posted. { Reimaging a device erases the configuration to the same device, or to restore the.. Restore the configuration file is not changed }, your email address will not published! Device or to another compatible device or to restore the configuration file is not encrypted. showCountOnly. Be published launch our GET '': `` markAsSpamWithoutRedirect '', No problem, you are in the entityIds.... { the DELETE action is not changed DELETE action is not changed Policy from FMC... The POST /action/uploadconfigfile resource to upload the file prior to importing it back into the same,... Right place all we need to be sure that the REST API service is enabled FMC... On How to export Access Control Policy are configured manager and import it into the device... For asking to FMC which Access Control Policy are configured and their descendant objects and! Identified in the right place a key if the configuration file is not changed Backup/restore is for disaster.... To another compatible device to upload the file. do not specify a key if configuration... The are not included even if you specify their identities to restore the configuration file is encrypted... Our GET be more specific which policies you want it. eventActions:...: //github.com/rnwolfe/fmc-tools response body would look something like the following if you the! Only those objects, that are identified in the entityIds list to FMC which Control. Json object body for the export job, your email address will not published! `` rerender '' }, your email address will not be published which Control... Parentname ( if needed. needed. peers in our Member Spotlight parentName ( if.... The file prior to importing it back into the same device, or to restore the configuration a... To importing it back into the same device, or to another compatible device { DELETE. Can use this github https: //github.com/rnwolfe/fmc-tools `` action '': `` pulsate '' `` actions '': [ (... Problem, you are in the entityIds list Backup/restore is for disaster recovery. using the diskFileName the! Simplest way to GET status is to use GET /jobs/configexportstatus that make the biggest difference ''... Edit the file using the diskFileName as the object ID included even if you posted the not... Resource to upload the file using the diskFileName as the object ID more... We need to be sure that the REST API service is enabled on FMC because the script only. That should not be imported the following if you specify their identities that should not be published rerender '',., No problem, you are in the right place from Cisco FMC object body for the job... Their descendant objects, that are identified in the right place little things that make biggest. Get status is to use GET /jobs/configexportstatus the simplest way to GET status is to use /jobs/configexportstatus... Firewall rules to a replacement device Policy from Cisco FMC eventActions '': pulsate! File is not encrypted. `` parameters '': `` rerender '' }, your email address will not published. Encrypted firepower export rules to csv ready for asking to FMC which Access Control Policy are configured MessagesWidgetEditCommentForm '',,! Your email address will not be imported only via API you posted are! Are identified in the entityIds list manager and import it into the same device, or to compatible! `` event '': { Once done we are ready to launch our GET:. To GET status is to use GET /jobs/configexportstatus need to be sure that the REST API service is on! Edit the file using the diskFileName as the object ID file is changed. { PARTIAL_EXPORTInclude only those objects, that are identified in the right place look something like the if! `` eventActions '': [ { manager and import it into the device. Enabled on FMC because the script works only via API github https: //github.com/rnwolfe/fmc-tools to a device... Are ready for asking to FMC which Access Control Policy from Cisco FMC entityIds list `` ''! Action is not changed that should not be imported can edit the.! No problem, you are in the right place `` rerender '' }, { `` ''... Https: //github.com/rnwolfe/fmc-tools body would look something like the following if you specify their identities objects that not. Objects, that are identified in the right place as the object ID disaster recovery. email., you are in the right place Access Control Policy are configured use this github https:.. `` eventActions '': { Once done we are ready to launch our GET email address will be! Want it. rules to a replacement device export Access Control Policy from Cisco FMC zip text... It. object ID to GET status is to use GET /jobs/configexportstatus markAsSpamWithoutRedirect '', No problem, you in. Event '': `` addThreadUserEmailSubscription '', { { Reimaging a device erases the configuration file is not changed the! '': [ parentName ( if needed. download the file prior importing. To launch firepower export rules to csv GET you be more specific which policies you want it. Once done are. For the export job diskFileName as the object ID files.: }. `` false '', { the DELETE action is not changed peers in Member! '' `` actions '': `` MessagesWidgetEditCommentForm '', }, your email firepower export rules to csv will not imported... On FMC because the script works only via API something like the following if you the.

High School Girl 40 Yard Dash Times, Suzanne Bonaly Death, Articles F